PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_76757.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 341aa    MW: 37065.6 Da    PI: 8.7367
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_76757.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.33.9e-31176232158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  MLOC_76757.4 176 DAPVYVNAKQYEGILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 232
                   68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-35174235IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.736175235IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.7E-23178200IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.7E-28178232IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.7E-23209232IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MMSFKNHHEG FTGQHLVAAA AASQASGGAP LPWWVGSQLL YGEPMGHGKA PPAVPVSMSP  60
PQDACRDGQF QVVPRGGQPL LDAVPLPPQP MPERGIPEAL KFSMAHGKGG NSSEHSAPIT  120
LQSPFTEYND HFELGLGQSV ISSSYYSDQQ YGLLSSYAMR SAYSGRMLIP LNMPADAPVY  180
VNAKQYEGIL RRRRARAKAE KENRLVKARK PYLHESRHLH AMRRARGSGG RFLNTKKETN  240
GKDTGVGSTA MGGNQFMRPT ASLSSEIQHS EQGNPSSVSS LSGSEVTSLY DHEDVDHYHN  300
FEHLRTHFFT PLPSIMDGEH GAGNPFKWAA ASDGCCNLLK A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-17176240266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3770240.0AK377024.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3145N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577268.11e-147PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-147PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_014757443.11e-147PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLF2ELJ60.0F2ELJ6_HORVD; Predicted protein
STRINGMLOC_76757.20.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.38e-27nuclear factor Y, subunit A10